Recombinant Protein of Mouse MRPS18A, aa 35-196(Cat#: RIJL-0225-JL499)
This product is a recombinant mouse MRPS18A protein with specific tag. It is availible for immunogen, SDS-PAGE and WB.
Summary
Related Products & Services
Description
|
This product is a recombinant mouse MRPS18A protein with specific tag. It is availible for immunogen, SDS-PAGE and WB. |
Product Property
Species Reactivity |
Mouse |
Molecule Mass |
22.3 kDa |
Purity |
>85% determined by SDS-PAGE |
Endotoxin |
<1.0EU per 1µg (determined by the LAL method) |
Expression Host |
Yeast; E.coli; Baculovirus; Mammalian Cell |
Formulation |
Tris/PBS-based buffer, 6% Trehalose |
Residues |
35-196aa |
Sequence |
LREVVKIQEGKTTVIEGRITETPKATPDPPNPSGQCPICRWNLKHKYTYEDVLLLSQFIRPYGGMLPRRVTGLCREEHRKIEECVKMAHRAGLLPNHRPQLPEGCLPKDKPKLNRYLTRWAPKSVKPIYKKGHRWNKVGMAVGSPLLKDNVCYSRRPLKMMH |
Product Form |
Lyophilized powder |
Tags |
Tag type will be determined during the manufacturing process. |
Type |
Recombinant Protein |
Applications |
Immunogen; SDS-PAGE; WB |
Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
Alternative Names |
Large Ribosomal Subunit Protein ML66; Mitochondrial Large Ribosomal Subunit Protein BS18m-A; Mitochondrial Ribosomal Protein S18A; MRPS18-3; Large Ribosomal Subunit Protein BS18a; Mrps18a |
Gene ID |
68565 |
UniProt ID |
Q99N85 |
Location |
Mitochondrion |
Introduction |
MRPS18A protein functions as a crucial structural element within the small subunit of the mitochondrial ribosome, residing solely within mitochondria and playing an indispensable role in the efficient production of mitochondrial proteins. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.