Recombinant Protein of Human MRPS18A, aa 35-196(Cat#: RIJL-0225-JL497)
This product is a recombinant human MRPS18A protein with specific tag. It is availible for WB, bioactivity testing, immunogen, ELISA and SDS-PAGE.
Summary
Related Products & Services
Description
|
This product is a recombinant human MRPS18A protein with specific tag. It is availible for WB, bioactivity testing, immunogen, ELISA and SDS-PAGE. |
Product Property
| Species Reactivity |
Human |
| Molecule Mass |
14.0 kDa |
| Purity |
>85% determined by SDS-PAGE |
| Endotoxin |
<1.0EU per 1µg (determined by the LAL method) |
| Expression Host |
E.coli |
| Formulation |
Tris/PBS-based buffer, 6% Trehalose |
| Residues |
35-196aa |
| Sequence |
FREVVETQEGKTTIIEGRITATPKESPNPPNPSGQCPICRWNLKHKYNYDDVLLLSQFIRPHGGMLPRKITGLCQEEHRKIEECVKMAHRAGLLPNHRPRLPEGVVPKSKPQLNRYLTRWAPGSVKPIYKKGPRWNRVRMPVGSPLLRDNVCYSRTPWKLYH |
| Product Form |
Lyophilized powder |
| Tags |
Tag type will be determined during the manufacturing process. |
| Type |
Recombinant Protein |
| Applications |
WB; Bioactivity Testing; Immunogen; ELISA; SDS-PAGE |
| Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names |
Mitochondrial Ribosomal Protein S18A; MRPS18-3; Large Ribosomal Subunit Protein BS18a; Large Ribosomal Subunit Protein ML66; Mitochondrial Large Ribosomal Subunit Protein BS18m-A; Mrps18a |
| Gene ID |
55168 |
| UniProt ID |
Q9NVS2 |
| Location |
Mitochondrion |
| Introduction |
MRPS18A protein functions as a crucial structural element within the small subunit of the mitochondrial ribosome, residing solely within mitochondria and playing an indispensable role in the efficient production of mitochondrial proteins. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.