Recombinant Protein of Human MRPS18A, aa 35-196(Cat#: RIJL-0225-JL497)
This product is a recombinant human MRPS18A protein with specific tag. It is availible for WB, bioactivity testing, immunogen, ELISA and SDS-PAGE.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human MRPS18A protein with specific tag. It is availible for WB, bioactivity testing, immunogen, ELISA and SDS-PAGE. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 14.0 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 35-196aa |
| Sequence | FREVVETQEGKTTIIEGRITATPKESPNPPNPSGQCPICRWNLKHKYNYDDVLLLSQFIRPHGGMLPRKITGLCQEEHRKIEECVKMAHRAGLLPNHRPRLPEGVVPKSKPQLNRYLTRWAPGSVKPIYKKGPRWNRVRMPVGSPLLRDNVCYSRTPWKLYH |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | WB; Bioactivity Testing; Immunogen; ELISA; SDS-PAGE |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Mitochondrial Ribosomal Protein S18A; MRPS18-3; Large Ribosomal Subunit Protein BS18a; Large Ribosomal Subunit Protein ML66; Mitochondrial Large Ribosomal Subunit Protein BS18m-A; Mrps18a |
| Gene ID | 55168 |
| UniProt ID | Q9NVS2 |
| Location | Mitochondrion |
| Introduction | MRPS18A protein functions as a crucial structural element within the small subunit of the mitochondrial ribosome, residing solely within mitochondria and playing an indispensable role in the efficient production of mitochondrial proteins. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
