Recombinant Protein of Human MRPS33, aa 1-106(Cat#: RIJL-0225-JL530)
This product is a recombinant human MRPS33 protein with N-terminal His Tag. It is availible for immunogen, SDS-PAGE, WB, bioactivity testing and ELISA.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human MRPS33 protein with N-terminal His Tag. It is availible for immunogen, SDS-PAGE, WB, bioactivity testing and ELISA. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 12.6 kDa |
| Purity | >80% determined by SDS-PAGE |
| Endotoxin | Low endotoxin |
| Expression Host | E.coli |
| Formulation | 25 mM Tris-HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Residues | 1-106aa |
| Sequence | MSSLSEYAFRMSRLSARLFGEVTRPTNSKSMKVVKLFSELPLAKKKETYDWYPNHHTYAELMQTLRFLGLYRDEHQDFMDEQKRLKKLRGKEKPKKGEGKRAAKRK |
| Product Form | Lyophilized powder |
| Tags | N-terminal His Tag |
| Type | Recombinant Protein |
| Applications | Immunogen; SDS-PAGE; WB; Bioactivity Testing; ELISA |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | MRPS33; CGI-139; PTD003; MRP-S33; S33mt |
| Gene ID | 51650 |
| UniProt ID | Q9Y291 |
| Location | Mitochondrion |
| Introduction | MRPS33 protein is a key constituent of the mitochondrial ribosomal small subunit, playing a pivotal role in the synthesis of mitochondrial proteins that are crucial for aerobic energy production. Mutations in the MRPS33 gene have been linked to a spectrum of mitochondrial diseases, often presenting with clinical features such as muscle weakness, developmental delays, and neurological impairments, underscoring its importance in maintaining mitochondrial function and overall cellular health. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
