Recombinant Protein of Bovine MRPS33, aa 2-106(Cat#: RIJL-0225-JL531)
This product is a recombinant bovine MRPS33 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB.
Summary
Related Products & Services
Description
|
This product is a recombinant bovine MRPS33 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB. |
Product Property
Species Reactivity |
Bovine |
Molecule Mass |
12.5 kDa |
Purity |
>85% determined by SDS-PAGE |
Endotoxin |
<1.0EU per 1µg (determined by the LAL method) |
Expression Host |
E.coli |
Formulation |
Tris/PBS-based buffer, 6% Trehalose |
Residues |
2-106aa |
Sequence |
SSLSEYALRMSRLSARLFSEVARPTDSKSMKVVKLFSEQPLAKRKETYDWYPNHNTYFALMGILRSVGLYRDEHQDFKDEQLRLKKLRGKVKPRKGEGKRAAKKK |
Product Form |
Lyophilized powder |
Tags |
Tag type will be determined during the manufacturing process. |
Type |
Recombinant Protein |
Applications |
Immunogen; SDS-PAGE; WB |
Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
Alternative Names |
CGI-139; PTD003; MRP-S33; MRPS33; S33mt |
Gene ID |
523435 |
UniProt ID |
P82926 |
Location |
Mitochondrion |
Introduction |
MRPS33 protein is a key constituent of the mitochondrial ribosomal small subunit, playing a pivotal role in the synthesis of mitochondrial proteins that are crucial for aerobic energy production. Mutations in the MRPS33 gene have been linked to a spectrum of mitochondrial diseases, often presenting with clinical features such as muscle weakness, developmental delays, and neurological impairments, underscoring its importance in maintaining mitochondrial function and overall cellular health. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.