Recombinant Protein of Bovine MRPS33, aa 2-106(Cat#: RIJL-0225-JL531)
This product is a recombinant bovine MRPS33 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant bovine MRPS33 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB. |
Product Property
| Species Reactivity | Bovine |
| Molecule Mass | 12.5 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 2-106aa |
| Sequence | SSLSEYALRMSRLSARLFSEVARPTDSKSMKVVKLFSEQPLAKRKETYDWYPNHNTYFALMGILRSVGLYRDEHQDFKDEQLRLKKLRGKVKPRKGEGKRAAKKK |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | Immunogen; SDS-PAGE; WB |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | CGI-139; PTD003; MRP-S33; MRPS33; S33mt |
| Gene ID | 523435 |
| UniProt ID | P82926 |
| Location | Mitochondrion |
| Introduction | MRPS33 protein is a key constituent of the mitochondrial ribosomal small subunit, playing a pivotal role in the synthesis of mitochondrial proteins that are crucial for aerobic energy production. Mutations in the MRPS33 gene have been linked to a spectrum of mitochondrial diseases, often presenting with clinical features such as muscle weakness, developmental delays, and neurological impairments, underscoring its importance in maintaining mitochondrial function and overall cellular health. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
