Recombinant Protein of Human MRPL51, aa 1-128(Cat#: RIJL-0225-JL450)
This product is a recombinant human MRPL51 protein with Flag Tag. It is availible for SDS-PAGE, WB, bioactivity testing, immunogen and ELISA.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human MRPL51 protein with Flag Tag. It is availible for SDS-PAGE, WB, bioactivity testing, immunogen and ELISA. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 14.9 kDa |
| Purity | >90% determined by SDS-PAGE |
| Endotoxin | Low endotoxin |
| Expression Host | 293T Cells |
| Formulation | 25mM Tris-HCl, pH 7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProtein inhibitor cocktail mix, 1mM PMSF and 1mM NA₃VO₄ |
| Residues | 1-128aa |
| Sequence | MAGNLLSGAGRRLWDWVPLACRSFSLGVPRLIGIRLTLPPPKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNRHGKFR |
| Product Form | Lyophilized powder |
| Tags | Flag Tag |
| Type | Recombinant Protein |
| Applications | SDS-PAGE; WB; Bioactivity Testing; Immunogen; ELISA |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Mitochondrial Ribosomal Protein L51; BMRP64; MRP64; Large Ribosomal Subunit Protein ML51; Mitochondrial Large Ribosomal Subunit Protein ML51 |
| Gene ID | 51258 |
| UniProt ID | Q4U2R6 |
| Location | Mitochondrion |
| Introduction | MRPL51 is a vital component of the mitochondrial large ribosomal subunit, playing an indispensable role in the translation of mitochondrial mRNAs into functional proteins. Its presence ensures the accurate assembly and operational integrity of the mitochondrial ribosomal complex, critical for energy production and overall cellular health. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
