Recombinant Protein of Mouse MRPL51, aa 32-128(Cat#: RIJL-0225-JL452)
This product is a recombinant mouse MRPL51 protein with specific tag. It is availible for SDS-PAGE, bioactivity testing, immunogen, ELISA and WB.
Summary
Related Products & Services
Description
|
This product is a recombinant mouse MRPL51 protein with specific tag. It is availible for SDS-PAGE, bioactivity testing, immunogen, ELISA and WB. |
Product Property
| Species Reactivity |
Mouse |
| Molecule Mass |
15.1 kDa |
| Purity |
>85% determined by SDS-PAGE |
| Endotoxin |
<1.0EU per 1µg (determined by the LAL method) |
| Expression Host |
E.coli |
| Formulation |
Tris/PBS-based buffer, 6% Trehalose |
| Residues |
32-128aa |
| Sequence |
AFVRLTLPPPKVVDRWNEKRALFGVYDNIGILGNFEKHPKELIKGPVWLRGWRGNELQRCVRKKKFVGNRMFIEDLHNLNKRISYLYKHFNRHGKYR |
| Product Form |
Lyophilized powder |
| Tags |
Tag type will be determined during the manufacturing process. |
| Type |
Recombinant Protein |
| Applications |
SDS-PAGE; Bioactivity Testing; Immunogen; ELISA; WB |
| Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names |
Large Ribosomal Subunit Protein ML51; Mitochondrial Ribosomal Protein L51; BMRP64; MRP64; Mitochondrial Large Ribosomal Subunit Protein ML51 |
| Gene ID |
66493 |
| UniProt ID |
Q9CPY1 |
| Location |
Mitochondrion |
| Introduction |
MRPL51 is a vital component of the mitochondrial large ribosomal subunit, playing an indispensable role in the translation of mitochondrial mRNAs into functional proteins. Its presence ensures the accurate assembly and operational integrity of the mitochondrial ribosomal complex, critical for energy production and overall cellular health. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.