Recombinant Protein of Bovine MRPL51, aa 32-128(Cat#: RIJL-0225-JL451)
This product is a recombinant bovine MRPL51 protein with specific tag. It is availible for WB, standard, immunogen, ELISA and SDS-PAGE.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant bovine MRPL51 protein with specific tag. It is availible for WB, standard, immunogen, ELISA and SDS-PAGE. |
Product Property
| Species Reactivity | Bovine |
| Molecule Mass | 15.2 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 32-128aa |
| Sequence | FHVRVTLPPPKVIDRWNQKRAMFGVYDNIGILGNFEKHPKELIKGPVWLRGWKGNELQRCIRKKRMVGNRMFIDDLHNLNKRISFLYKRFNRHGKHR |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | WB; Standard; Immunogen; ELISA; SDS-PAGE |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Large Ribosomal Subunit Protein ML51; Mitochondrial Large Ribosomal Subunit Protein ML51; Mitochondrial Ribosomal Protein L51; BMRP64; MRP64 |
| Gene ID | 513622 |
| UniProt ID | P0C2B6 |
| Location | Mitochondrion |
| Introduction | MRPL51 is a vital component of the mitochondrial large ribosomal subunit, playing an indispensable role in the translation of mitochondrial mRNAs into functional proteins. Its presence ensures the accurate assembly and operational integrity of the mitochondrial ribosomal complex, critical for energy production and overall cellular health. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
