Loading...
Book a Meeting

Recombinant Protein of Pig RPS12, aa 2-132(Cat#: RIJL-0225-JL346)

This product is a recombinant pig RPS12 protein with specific tag. It is availible for WB, SDS-PAGE, bioactivity testing, ELISA and immunogen.

Certificate of Analysis (COA)

To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].

Lot Number
Summary Related Products & Services

Description

This product is a recombinant pig RPS12 protein with specific tag. It is availible for WB, SDS-PAGE, bioactivity testing, ELISA and immunogen.

Product Property

Species Reactivity Pig
Molecule Mass 14.5 kDa
Purity >85% determined by SDS-PAGE
Endotoxin <1.0EU per 1µg (determined by the LAL method)
Expression Host Yeast; E.coli; Baculovirus; Mammalian Cell
Formulation Tris/PBS-based buffer, 6% Trehalose
Residues 2-132aa
Sequence AEEGITAGGVMDVNTALQEVLKTALIHDGLARGIREAAKALDKRQAHLCVLASNCDEPMYVKLVEALCAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKDYGKESQAKDVIEEYFKCKK
Product Form Lyophilized powder
Tags Tag type will be determined during the manufacturing process.
Type Recombinant Protein
Applications WB; SDS-PAGE; Bioactivity Testing; ELISA; Immunogen
Storage Store at -20°C/-80°C. Avoid freeze-thaw cycles.

Target

Alternative Names 40S Ribosomal Protein S12; Small Ribosomal Subunit Protein ES12; Ribosomal Protein S12
Gene ID 397650
UniProt ID P46405
Location Nucleolus; Nucleus
Introduction RPS12 protein is a fundamental building block of the small ribosomal subunit in eukaryotic cells. It plays a crucial role in the translation machinery, aiding in the precise assembly and functional integrity of the ribosome. RPS12 is indispensable for the efficient synthesis of proteins, which are vital for cellular growth, energy production, and overall cellular function.
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
Inquiry