Recombinant Protein of Chicken RPS12, aa 2-132(Cat#: RIJL-0225-JL345)
This product is a recombinant chicken RPS12 protein with specific tag. It is availible for bioactivity testing, WB, immunogen, SDS-PAGE and ELISA.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant chicken RPS12 protein with specific tag. It is availible for bioactivity testing, WB, immunogen, SDS-PAGE and ELISA. |
Product Property
| Species Reactivity | Chicken |
| Molecule Mass | 14.5 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 2-132aa |
| Sequence | AEEGITAGGVMDVNTALQEVLKTALIHDGLARGIREAAKALDKRQAHLCVLASNCDEPMYVKLVEALCAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKDYGKESQAKDVIEEYFKCKK |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | Bioactivity Testing; WB; Immunogen; SDS-PAGE; ELISA |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Small Ribosomal Subunit Protein ES12; Ribosomal Protein S12; 40S Ribosomal Protein S12 |
| Gene ID | 421698 |
| UniProt ID | P84175 |
| Location | Nucleus; Nucleolus |
| Introduction | RPS12 protein is a fundamental building block of the small ribosomal subunit in eukaryotic cells. It plays a crucial role in the translation machinery, aiding in the precise assembly and functional integrity of the ribosome. RPS12 is indispensable for the efficient synthesis of proteins, which are vital for cellular growth, energy production, and overall cellular function. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
