Recombinant Protein of Mouse MRPS24, aa 36-167(Cat#: RIJL-0225-JL511)
This product is a recombinant mouse MRPS24 protein with specific tag. It is availible for positive control, immunogen, SDS-PAGE and WB.
Summary
Related Products & Services
Description
|
This product is a recombinant mouse MRPS24 protein with specific tag. It is availible for positive control, immunogen, SDS-PAGE and WB. |
Product Property
Species Reactivity |
Mouse |
Molecule Mass |
18.9 kDa |
Purity |
>85% determined by SDS-PAGE |
Endotoxin |
<1.0EU per 1µg (determined by the LAL method) |
Expression Host |
Yeast; E.coli; Baculovirus; Mammalian Cell |
Formulation |
Tris/PBS-based buffer, 6% Trehalose |
Residues |
36-167aa |
Sequence |
KNRAARVRVAKGNKPVSYEEAHAPHYIAHRKGWLSLHTGNLDGEDHAAERTLEDVFLRKFMMGTFPGCLADQIVLKRRANQVDICALVLRQLPAHKFYFLVGYSETLLSHFYKCPVRLHLQTVPSKVVYKYI |
Product Form |
Lyophilized powder |
Tags |
Tag type will be determined during the manufacturing process. |
Type |
Recombinant Protein |
Applications |
Positive Control; Immunogen; SDS-PAGE; WB |
Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
Alternative Names |
BMRP-47; HSPC335; S24mt; MRP-S24; MRPS24; BMRP47 |
Gene ID |
64660 |
UniProt ID |
Q9CQV5 |
Location |
Mitochondrion |
Introduction |
Distributed within the mitochondrial matrix, MRPS24 facilitates the accurate assembly and translation of mitochondrial mRNAs into functional proteins, which are vital for energy production through oxidative phosphorylation. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.