Recombinant Protein of Human MRPS24, aa 1-167(Cat#: RIJL-0225-JL510)
This product is a recombinant human MRPS24 protein with GST Tag. It is availible for antibody production and standard.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human MRPS24 protein with GST Tag. It is availible for antibody production and standard. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 45.4 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | Low endotoxin |
| Expression Host | Wheat Germ |
| Formulation | 50 mM Tris-HCl, pH 8.0, 10 mM reduced glutathione |
| Residues | 1-167aa |
| Sequence | MAASVCSGLLGPRVLSWSRELPCAWRALHTSPVCAKNRAARVRVSKGDKPVTYEEAHAPHYIAHRKGWLSLHTGNLDGEDHAAERTVEDVFLRKFMWGTFPGCLADQLVLKRRGNQLEICAVVLRQLSPHKYYFLVGYSETLLSYFYKCPVRLHLQTVPSKVVYKYL |
| Product Form | Lyophilized powder |
| Tags | GST Tag |
| Type | Recombinant Protein |
| Applications | Antibody Production; Standard |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | MRPS24; BMRP47; BMRP-47; HSPC335; S24mt; MRP-S24 |
| Gene ID | 64951 |
| UniProt ID | Q96EL2 |
| Location | Mitochondrion |
| Introduction | Distributed within the mitochondrial matrix, MRPS24 facilitates the accurate assembly and translation of mitochondrial mRNAs into functional proteins, which are vital for energy production through oxidative phosphorylation. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
