Recombinant Protein of Mouse MRPS15, aa 58-258(Cat#: RIJL-0225-JL490)
This product is a recombinant mouse MRPS15 protein with specific tag. It is availible for immunogen, SDS-PAGE, ELISA and standard.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant mouse MRPS15 protein with specific tag. It is availible for immunogen, SDS-PAGE, ELISA and standard. |
Product Property
| Species Reactivity | Mouse |
| Molecule Mass | 29.5 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 58-258aa |
| Sequence | PVQPKQDDEPPSSAFIKEYKDIIPNIEKVDDVVKRILSLEMASRKEKLKIKQEQLMNKIVENPEDSRTLEAQIIALTVRIRNYEEHMQKHRKDKAHKRHLLMSIDRRKKLLKILRQTNYDVFEKTCKELGVEYTLPPLHFQKVHRRFLAKKALCIRVYQEVQKLKKQKRALKAAAAAAKKEKNEGVPENPSNAVPEKTQVN |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | Immunogen; SDS-PAGE; ELISA; Standard |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | RPMS15; S15mt; MPR-S15; MRPS15; DC37; MRP-S15 |
| Gene ID | 66407 |
| UniProt ID | Q9DC71 |
| Location | Mitochondrion |
| Introduction | Distributed across various tissues, with particularly high expression levels in energy-intensive organs such as the heart and muscles, MRPS15 is indispensable for maintaining efficient mitochondrial function and energy production. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
