Recombinant Protein of Human MRPS15, aa 1-257(Cat#: RIJL-0225-JL488)
This product is a recombinant human MRPS15 protein with N-terminal His Tag. It is availible for WB, standard, immunogen, ELISA and SDS-PAGE.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human MRPS15 protein with N-terminal His Tag. It is availible for WB, standard, immunogen, ELISA and SDS-PAGE. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 29.8 kDa |
| Purity | >90% determined by SDS-PAGE |
| Endotoxin | Low endotoxin |
| Expression Host | E.coli |
| Formulation | 25 mM Tris-HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Residues | 1-257aa |
| Sequence | MLRVAWRTLSLIRTRAVTQVLVPGLPGGGSAKFPFNQWGLQPRSLLLQAARGYVVRKPAQSRLDDDPPPSTLLKDYQNVPGIEKVDDVVKRLLSLEMANKKEMLKIKQEQFMKKIVANPEDTRSLEARIIALSVKIRSYEEHLEKHRKDKAHKRYLLMSIDQRKKMLKNLRNTNYDVFEKICWGLGIEYTFPPLYYRRAHRRFVTKKALCIRVFQETQKLKKRRRALKAAAAAQKQAKRRNPDSPAKAIPKTLKDSQ |
| Product Form | Lyophilized powder |
| Tags | N-terminal His Tag |
| Type | Recombinant Protein |
| Applications | WB; Standard; Immunogen; ELISA; SDS-PAGE |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | MRPS15; DC37; RPMS15; S15mt; MPR-S15; MRP-S15 |
| Gene ID | 64960 |
| UniProt ID | P82914 |
| Location | Mitochondrion |
| Introduction | Distributed across various tissues, with particularly high expression levels in energy-intensive organs such as the heart and muscles, MRPS15 is indispensable for maintaining efficient mitochondrial function and energy production. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
