Recombinant Protein of Mouse CHCHD1, aa 1-118(Cat#: RIJL-0225-JL537)
This product is a recombinant mouse CHCHD1 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant mouse CHCHD1 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB. |
Product Property
| Species Reactivity | Mouse |
| Molecule Mass | 13.6 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 1-118aa |
| Sequence | MATPSLRGRLARFANPGKPILKPNKPLILANRVGNRRREKGEATCITEMSMMMACWKQNEFRDEACRKEIQDFFDCSSRAQEARKMRSIQESLGQSESLSPHKMTKLLQRFPNKSHLI |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | Immunogen; SDS-PAGE; WB |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 1; Nuclear Protein C2360; MRP-S37; Small Ribosomal Subunit Protein MS37; Mitochondrial Small Ribosomal Subunit Protein MS37 |
| Gene ID | 66121 |
| UniProt ID | Q9CQA6 |
| Location | Mitochondrion |
| Introduction | The CHCHD1 protein is a conserved mitochondrial inner membrane protein with a pivotal role in maintaining mitochondrial morphology and function. It belongs to a family of coiled-coil-helix-coiled-coil-helix domain-containing proteins and is involved in the regulation of mitochondrial dynamics and cristae organization. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
