Recombinant Protein of Human CHCHD1, aa 1-118(Cat#: RIJL-0225-JL536)
This product is a recombinant human CHCHD1 protein with specific tag. It is availible for SDS-PAGE, WB, bioactivity testing and ELISA.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human CHCHD1 protein with specific tag. It is availible for SDS-PAGE, WB, bioactivity testing and ELISA. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 13.5 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 1-118aa |
| Sequence | MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMSVMMACWKQNEFRDDACRKEIQGFLDCAARAQEARKMRSIQETLGESGSLLPNKLNKLLQRFPNKPYLS |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | SDS-PAGE; WB; Bioactivity Testing; ELISA |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 1; Small Ribosomal Subunit Protein MS37; Nuclear Protein C2360; MRP-S37; Mitochondrial Small Ribosomal Subunit Protein MS37 |
| Gene ID | 118487 |
| UniProt ID | Q96BP2 |
| Location | Mitochondrion |
| Introduction | The CHCHD1 protein is a conserved mitochondrial inner membrane protein with a pivotal role in maintaining mitochondrial morphology and function. It belongs to a family of coiled-coil-helix-coiled-coil-helix domain-containing proteins and is involved in the regulation of mitochondrial dynamics and cristae organization. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
