Recombinant Protein of Human RPS4Y1, aa 1-263(Cat#: RIJL-0225-JL328)
This product is a recombinant human RPS4Y1 protein with N-terminal 10xHis-tag or C-terminal Myc-tag. It is availible for standard, immunogen and SDS-PAGE.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human RPS4Y1 protein with N-terminal 10xHis-tag or C-terminal Myc-tag. It is availible for standard, immunogen and SDS-PAGE. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 36.9 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 1-263aa |
| Sequence | MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKICMQRFIKIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAKYKLCKVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISLPRGKGIRLTVAEERDKRLATKQSSG |
| Product Form | Lyophilized powder |
| Tags | N-terminal 10xHis-tag; C-terminal Myc-tag |
| Type | Recombinant Protein |
| Applications | Standard; Immunogen; SDS-PAGE |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Ribosomal Protein S4 Y-Linked 1; RPS4Y; Small Ribosomal Subunit Protein ES4, Y Isoform 1; Ribosomal Protein S4Y; Small Ribosomal Subunit Protein ES4; 40S Ribosomal Protein S4 |
| Gene ID | 6192 |
| UniProt ID | P22090 |
| Location | Cytosol; Nucleoplasm; Nucleus |
| Introduction | The RPS4Y1 protein, specifically found on the Y chromosome, is a unique ribosomal protein that plays a distinct role in male biology. It contributes to the structural integrity and functional efficiency of the ribosome. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
