Recombinant Protein of Human MRPS6, aa 1-125(Cat#: RIJL-0225-JL470)
This product is a recombinant human MRPS6 protein with Flag Tag. It is availible for WB, bioactivity testing, immunogen, ELISA and SDS-PAGE.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human MRPS6 protein with Flag Tag. It is availible for WB, bioactivity testing, immunogen, ELISA and SDS-PAGE. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 14.0 kDa |
| Purity | >90% determined by SDS-PAGE |
| Endotoxin | Low endotoxin |
| Expression Host | 293T Cells |
| Formulation | 25mM Tris-HCl, pH 7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProtein inhibitor cocktail mix, 1mM PMSF and 1mM NA₃VO₄ |
| Residues | 1-125aa |
| Sequence | MPRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNRGGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK |
| Product Form | Lyophilized powder |
| Tags | Flag Tag |
| Type | Recombinant Protein |
| Applications | WB; Bioactivity Testing; Immunogen; ELISA; SDS-PAGE |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Mitochondrial Ribosomal Protein S6; MRP-S6; RPMS6; Small Ribosomal Subunit Protein BS6m; Mitochondrial Small Ribosomal Subunit Protein BS6m |
| Gene ID | 64968 |
| UniProt ID | P82932 |
| Location | Mitochondrion |
| Introduction | MRPS6 is widely distributed across multiple tissues and organs, underscoring its universal importance in sustaining mitochondrial function and energy metabolism. Mutations or alterations in MRPS6 have been associated with a spectrum of diseases. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
