Recombinant Protein of Bovine MRPS6, aa 2-124(Cat#: RIJL-0225-JL471)
This product is a recombinant bovine MRPS6 protein with specific tag. It is availible for immunogen, SDS-PAGE and bioactivity testing.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant bovine MRPS6 protein with specific tag. It is availible for immunogen, SDS-PAGE and bioactivity testing. |
Product Property
| Species Reactivity | Bovine |
| Molecule Mass | 14.1 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 2-124aa |
| Sequence | PRYELALILKAMQRPETAAALKRTLEALMDRGAVVRSLENLGERTLPYKMSAHSQRHTRGGYFLVDFYAPTTTVASIMEHLSRDIDVIRPNVVKHPLTQEVKECEGIVPVPLEEKLYSTKKRK |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | Immunogen; SDS-PAGE; Bioactivity Testing |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | RPMS6; Small Ribosomal Subunit Protein BS6m; Mitochondrial Small Ribosomal Subunit Protein BS6m; Mitochondrial Ribosomal Protein S6; MRP-S6 |
| Gene ID | 615431 |
| UniProt ID | P82931 |
| Location | Mitochondrion |
| Introduction | MRPS6 is widely distributed across multiple tissues and organs, underscoring its universal importance in sustaining mitochondrial function and energy metabolism. Mutations or alterations in MRPS6 have been associated with a spectrum of diseases. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
