Recombinant Protein of Human MRPS16, aa 1-137(Cat#: RIJL-0225-JL491)
This product is a recombinant human MRPS16 protein with N-terminal GST Tag. It is availible for ELISA, immunogen, SDS-PAGE, WB and bioactivity testing.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human MRPS16 protein with N-terminal GST Tag. It is availible for ELISA, immunogen, SDS-PAGE, WB and bioactivity testing. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 38.5 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 1-137aa |
| Sequence | VAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET |
| Product Form | Lyophilized powder |
| Tags | N-terminal GST Tag |
| Type | Recombinant Protein |
| Applications | ELISA; Immunogen; SDS-PAGE; WB; Bioactivity Testing |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | 28S ribosomal protein S16; 28S ribosomal protein S16 mitochondrial; CGI-132; Mitochondrial ribosomal protein S16; MRP-S16; RPMS16 |
| Gene ID | 51021 |
| UniProt ID | Q9Y3D3 |
| Location | Mitochondrion |
| Introduction | MRPS16 protein is broadly distributed across various tissues and organs, where it contributes to the assembly and stability of the mitochondrial ribosome, enabling efficient synthesis of proteins critical for energy generation. Disruptions or mutations in the MRPS16 gene can lead to deficiencies in mitochondrial protein synthesis, often manifesting as mitochondrial diseases, which may encompass a spectrum of clinical manifestations ranging from neuromuscular disorders to metabolic abnormalities. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
