Recombinant Protein of Mouse MRPS16, aa 35-135(Cat#: RIJL-0225-JL493)
This product is a recombinant mouse MRPS16 protein with specific tag. It is availible for WB, bioactivity testing, immunogen, ELISA and SDS-PAGE.
Summary
Related Products & Services
Description
|
This product is a recombinant mouse MRPS16 protein with specific tag. It is availible for WB, bioactivity testing, immunogen, ELISA and SDS-PAGE. |
Product Property
| Species Reactivity |
Mouse |
| Molecule Mass |
15.2 kDa |
| Purity |
>85% determined by SDS-PAGE |
| Endotoxin |
<1.0EU per 1µg (determined by the LAL method) |
| Expression Host |
Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation |
Tris/PBS-based buffer, 6% Trehalose |
| Residues |
35-135aa |
| Sequence |
VAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLSGFFPLHPMMITNAERLRRRRAREVLLASQKAESEAKETEAS |
| Product Form |
Lyophilized powder |
| Tags |
Tag type will be determined during the manufacturing process. |
| Type |
Recombinant Protein |
| Applications |
WB; Bioactivity Testing; Immunogen; ELISA; SDS-PAGE |
| Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names |
Mitochondrial ribosomal protein S16; MRP-S16; RPMS16; 28S ribosomal protein S16; 28S ribosomal protein S16 mitochondrial; CGI-132 |
| Gene ID |
66242 |
| UniProt ID |
Q9CPX7 |
| Location |
Mitochondrion |
| Introduction |
MRPS16 protein is broadly distributed across various tissues and organs, where it contributes to the assembly and stability of the mitochondrial ribosome, enabling efficient synthesis of proteins critical for energy generation. Disruptions or mutations in the MRPS16 gene can lead to deficiencies in mitochondrial protein synthesis, often manifesting as mitochondrial diseases, which may encompass a spectrum of clinical manifestations ranging from neuromuscular disorders to metabolic abnormalities. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.