Recombinant Protein of Human MRPS10, aa 1-201(Cat#: RIJL-0225-JL478)
This product is a recombinant human MRPS10 protein with N-terminal GST Tag or C-terminal His Tag. It is availible for WB, bioactivity testing, immunogen, ELISA and SDS-PAGE.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human MRPS10 protein with N-terminal GST Tag or C-terminal His Tag. It is availible for WB, bioactivity testing, immunogen, ELISA and SDS-PAGE. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 50.8 kDa |
| Purity | >90% determined by SDS-PAGE |
| Endotoxin | Low endotoxin |
| Expression Host | E. coli |
| Formulation | 25 mM Tris-HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Residues | 1-201aa |
| Sequence | MAARTAFGAVCRRLWQGLGNFSVNTSKGNTAKNGGLLLSTNMKWVQFSNLHVDVPKDLTKPVVTISDEPDILYKRLSVLVKGHDKAVLDSYEYFAVLAAKELGISIKVHEPPRKIERFTLLQSVHIYKKHRVQYEMRTLYRCLELEHLTGSTADVYLEYIQRNLPEGVAMEVTKTQLEQLPEHIKEPIWETLSEEKEESKS |
| Product Form | Lyophilized powder |
| Tags | N-terminal GST Tag; C-terminal His Tag |
| Type | Recombinant Protein |
| Applications | WB; Bioactivity Testing; Immunogen; ELISA; SDS-PAGE |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | MRPS10; PNAS-122; S10mt; MRP-S10 |
| Gene ID | 55173 |
| UniProt ID | P82664 |
| Location | Mitochondrion |
| Introduction | MRPS10 is a key protein component of the mitochondrial small ribosomal subunit. Mutations or deficiencies in MRPS10 have been implicated in a range of diseases, including mitochondrial myopathies and neurodegenerative disorders, underscoring its critical importance in maintaining mitochondrial function and cellular health. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
