Recombinant Protein of Bovine MRPS10, aa 1-201(Cat#: RIJL-0225-JL479)
This product is a recombinant bovine MRPS10 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB.
Summary
Related Products & Services
Description
|
This product is a recombinant bovine MRPS10 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB. |
Product Property
| Species Reactivity |
Bovine |
| Molecule Mass |
23.0 kDa |
| Purity |
>85% determined by SDS-PAGE |
| Endotoxin |
<1.0EU per 1µg (determined by the LAL method) |
| Expression Host |
E.coli |
| Formulation |
Tris/PBS-based buffer, 6% Trehalose |
| Residues |
1-201aa |
| Sequence |
MAVRAVFGALGRRLWQGSKNFSVSSSRSNIAKNDGFLLSTSMKWVQFSNLHVDVPKDLTKPTITISDEPDTLYKRLSVLVKGHDKAVLDSYEYFAVLAAKELGISVKVHEPPRKIERFTLLKSVHIFKKHRVQYEMRTLYRCLELEHLTGSTADVYLEYIQRNLPEGVAMEVTKTRLEQLPEHIKKPVWETTPEEKGDSKS |
| Product Form |
Lyophilized powder |
| Tags |
Tag type will be determined during the manufacturing process. |
| Type |
Recombinant Protein |
| Applications |
Immunogen; SDS-PAGE; WB |
| Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names |
S10mt; MRP-S10; MRPS10; PNAS-122 |
| Gene ID |
515885 |
| UniProt ID |
P82670 |
| Location |
Mitochondrion |
| Introduction |
MRPS10 is a key protein component of the mitochondrial small ribosomal subunit. Mutations or deficiencies in MRPS10 have been implicated in a range of diseases, including mitochondrial myopathies and neurodegenerative disorders, underscoring its critical importance in maintaining mitochondrial function and cellular health. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.