Recombinant Protein of Bovine MRPS10, aa 1-201(Cat#: RIJL-0225-JL479)
This product is a recombinant bovine MRPS10 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant bovine MRPS10 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB. |
Product Property
| Species Reactivity | Bovine |
| Molecule Mass | 23.0 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 1-201aa |
| Sequence | MAVRAVFGALGRRLWQGSKNFSVSSSRSNIAKNDGFLLSTSMKWVQFSNLHVDVPKDLTKPTITISDEPDTLYKRLSVLVKGHDKAVLDSYEYFAVLAAKELGISVKVHEPPRKIERFTLLKSVHIFKKHRVQYEMRTLYRCLELEHLTGSTADVYLEYIQRNLPEGVAMEVTKTRLEQLPEHIKKPVWETTPEEKGDSKS |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | Immunogen; SDS-PAGE; WB |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | S10mt; MRP-S10; MRPS10; PNAS-122 |
| Gene ID | 515885 |
| UniProt ID | P82670 |
| Location | Mitochondrion |
| Introduction | MRPS10 is a key protein component of the mitochondrial small ribosomal subunit. Mutations or deficiencies in MRPS10 have been implicated in a range of diseases, including mitochondrial myopathies and neurodegenerative disorders, underscoring its critical importance in maintaining mitochondrial function and cellular health. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
