Recombinant Protein of Human MRPL30, aa 35-161(Cat#: RIJL-0225-JL423)
This product is a recombinant human MRPL30 protein with specific tag. It is availible for WB, ELISA, SDS-PAGE and immunogen.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human MRPL30 protein with specific tag. It is availible for WB, ELISA, SDS-PAGE and immunogen. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 15.2 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 35-161aa |
| Sequence | KFTRSRIPEKVFQASPEDHEKYGGDPQNPHKLHIVTRIKSTRRRPYWEKDIIKMLGLEKAHTPQVHKNIPSVNAKLKVVKHLIRIKPLKLPQGLPAEENMSNTCLKSTGELVVQWHLKPVEQKAHES |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | WB; ELISA; SDS-PAGE; Immunogen |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Mitochondrial Ribosomal Protein L30; MRP-L28; RPML28; Large Ribosomal Subunit Protein UL30m; Mitochondrial Large Ribosomal Subunit Protein UL30m |
| Gene ID | 51263 |
| UniProt ID | Q8TCC3 |
| Location | Mitochondrion |
| Introduction | MRPL30 occupies a pivotal position in the synthesis of mitochondrial proteins, which are indispensable for metabolic activities and the maintenance of cellular equilibrium. Serving as an integral part of the mitochondrial translational apparatus, MRPL30 promotes the precise assembly and functionality of the mitochondrial ribosome, thereby guaranteeing the accurate translation of genes encoded by mitochondrial DNA into fully functional proteins. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
