Recombinant Protein of Human MRPL11, aa 1-157(Cat#: RIJL-0225-JL395)
This product is a recombinant human MRPL11 protein with N-terminal His-IF2DI Tag. It is availible for WB and ELISA.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human MRPL11 protein with N-terminal His-IF2DI Tag. It is availible for WB and ELISA. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 37.5 kDa |
| Purity | >90% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | 10 mM Hepes, 150 mM NaCl with 5% trehalose, pH 7.4 |
| Residues | 1-157aa |
| Sequence | MSKLGRAARGLRKPEVGGVIRAIVRAGLAMPGPPLGPVLGQRGVSINQFCKEFNERTKDIKEGIPLPTKILVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARQTGKEVAGLVTLKHVYEIARIKAQDEAFALQDVPLSSVVRSIIGSARSLGIRVVK |
| Product Form | Lyophilized powder |
| Tags | N-terminal His-IF2DI Tag |
| Type | Recombinant Protein |
| Applications | Western Blot; ELISA |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Mitochondrial Ribosomal Protein L11; Large Ribosomal Subunit Protein UL11m; MRP-L11; Mitochondrial Large Ribosomal Subunit Protein UL11m |
| Gene ID | 65003 |
| UniProt ID | Q9Y3B7 |
| Location | Mitochondrion |
| Introduction | MRPL11, or Mitochondrial Ribosomal Protein L11, is a key component of the large ribosomal subunit in the mitochondrial ribosome of eukaryotic cells. It serves as a structural scaffold within the ribosome, playing a critical role in maintaining the architectural integrity and functional efficiency of the mitochondrial translational machinery. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
