Recombinant Protein of Chicken RPN2, aa 1-36(Cat#: RIJL-0225-JL315)
This product is a recombinant chicken RPN2 protein with specific tag. It is availible for WB, bioactivity testing, ELISA, immunogen and SDS-PAGE.
Summary
Related Products & Services
Description
|
This product is a recombinant chicken RPN2 protein with specific tag. It is availible for WB, bioactivity testing, ELISA, immunogen and SDS-PAGE. |
Product Property
Species Reactivity |
Chicken |
Molecule Mass |
3.9 kDa |
Purity |
>85% determined by SDS-PAGE |
Endotoxin |
<1.0EU per 1µg (determined by the LAL method) |
Expression Host |
Yeast; E.coli; Baculovirus; Mammalian Cell |
Formulation |
Tris/PBS-based buffer, 6% Trehalose |
Residues |
1-36aa |
Sequence |
NAIFSKKNFETLSEAFSVFQTLKYLAILGGVTFLAG |
Product Form |
Lyophilized powder |
Tags |
Tag type will be determined during the manufacturing process. |
Type |
Recombinant Protein |
Applications |
WB; Bioactivity Testing; ELISA; Immunogen; SDS-PAGE |
Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
Alternative Names |
Ribophorin-2; Ribophorin II; RPN-II; RPNII |
Gene ID |
419177 |
UniProt ID |
P80897 |
Location |
Cytoplasm |
Introduction |
RPN2 is a pivotal protein involved in the ubiquitin-proteasome system (UPS) of eukaryotic cells. This protein functions as a critical component of the proteasome, a large multi-subunit protease complex responsible for degrading ubiquitinated proteins. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.