Recombinant Protein of Chicken RPN2, aa 1-36(Cat#: RIJL-0225-JL315)
This product is a recombinant chicken RPN2 protein with specific tag. It is availible for WB, bioactivity testing, ELISA, immunogen and SDS-PAGE.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant chicken RPN2 protein with specific tag. It is availible for WB, bioactivity testing, ELISA, immunogen and SDS-PAGE. |
Product Property
| Species Reactivity | Chicken |
| Molecule Mass | 3.9 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 1-36aa |
| Sequence | NAIFSKKNFETLSEAFSVFQTLKYLAILGGVTFLAG |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | WB; Bioactivity Testing; ELISA; Immunogen; SDS-PAGE |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Ribophorin-2; Ribophorin II; RPN-II; RPNII |
| Gene ID | 419177 |
| UniProt ID | P80897 |
| Location | Cytoplasm |
| Introduction | RPN2 is a pivotal protein involved in the ubiquitin-proteasome system (UPS) of eukaryotic cells. This protein functions as a critical component of the proteasome, a large multi-subunit protease complex responsible for degrading ubiquitinated proteins. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
