Recombinant Protein of Bovine RPS27, aa 2-84(Cat#: RIJL-0225-JL380)
This product is a recombinant bovine RPS27 protein with specific tag. It is availible for WB, standard, immunogen, ELISA and SDS-PAGE.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant bovine RPS27 protein with specific tag. It is availible for WB, standard, immunogen, ELISA and SDS-PAGE. |
Product Property
| Species Reactivity | Bovine |
| Molecule Mass | 9.5 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 2-84aa |
| Sequence | PLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | WB; Standard; Immunogen; ELISA; SDS-PAGE |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | MPS1; Metallopanstimulin 1; Ribosomal Protein S27; 40S Ribosomal Protein S27 |
| Gene ID | 615638 |
| UniProt ID | Q2KHT7 |
| Location | Cytoplasm; Nucleolus; Nucleus |
| Introduction | RPS27, or Ribosomal Protein S27, is a key constituent of the small ribosomal subunit in eukaryotic organisms. It plays a vital role in the intricate process of translation, where it aids in the formation and stability of the ribosome, ensuring efficient protein synthesis. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
