Recombinant Protein of Mouse RPS10, aa 1-165(Cat#: RIJL-0225-JL341)
This product is a recombinant mouse RPS10 protein with specific tag. It is availible for bioactivity testing, SDS-PAGE, ELISA, WB and immunogen.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant mouse RPS10 protein with specific tag. It is availible for bioactivity testing, SDS-PAGE, ELISA, WB and immunogen. |
Product Property
| Species Reactivity | Mouse |
| Molecule Mass | 18.9 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 1-165aa |
| Sequence | MLMPKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGYVKEQFAWRHFYWYLTNEGIQYLRDYLHLPPEIVPATLRRSRPETGRPRPKGPEGERPARFTRGEADRDTYRRSAVPPGADKKAEAGAGSATEFQFRGGFGRGRGQPPQ |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | Bioactivity Testing; SDS-PAGE; ELISA; WB; Immunogen |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Small Ribosomal Subunit Protein ES10; 40S Ribosomal Protein S10; Ribosomal Protein S10 |
| Gene ID | 67097 |
| UniProt ID | P63325 |
| Location | Cytoplasm; Nucleolus; Nucleus |
| Introduction | RPS10 protein is a core component of the small ribosomal subunit in eukaryotic cells. It plays a pivotal role in the translation process, aiding in the precise assembly and stability of the ribosome. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
