Loading...
Book a Meeting

Recombinant Protein of Mouse NOL12, aa 1-217(Cat#: RIJL-1124-JL150)

This product is a recombinant mouse NOL12 protein with specific tag. It is availible for positive control, immunogen and SDS-PAGE.

Certificate of Analysis (COA)

To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].

Lot Number
Summary Related Products & Services

Description

This product is a recombinant mouse NOL12 protein with specific tag. It is availible for positive control, immunogen and SDS-PAGE.

Product Property

Species Reactivity Mouse
Purity >85% determined by SDS-PAGE
Endotoxin Low endotoxin
Expression Host Yeast; E.coli; Baculovirus; Mammalian Cell
Formulation PBS with 6% trehalose
Residues 1-217aa
Sequence MGRNKKKKKRDGDDRRPRLVLNFDEEKRREYLTGFHKRKVERKKAAIEEIKQRLKQEQKKLREERHQEYLKMLAEREEALEEADELERLVTAKTESVQYDHPNHTVTVTTISDLDLSGARLLGLPLPEQGDQDGSQEEEMSSLEKPTKALPRKSKDPLLSQRISSLTATLHAHSRKKVKRKHPRRAQDSTKKPPSATRTSKTQRRRRMTGKARHNGE
Product Form Lyophilized powder
Tags Tag type will be determined during the manufacturing process.
Type Recombinant Protein
Applications Positive Control; Immunogen; SDS-PAGE
Storage Store at -20°C/-80°C. Avoid freeze-thaw cycles.

Target

Alternative Names Nol12; Nop25; Nucleolar protein 12; Nucleolar protein of 25 kDa
Gene ID 97961
UniProt ID Q8BG17
Location Nucleus; Nucleolus
Introduction NOL12 is present in different subcellular compartments, including the nucleolus and nucleoplasm. Binding of NOL12 to ribosomal RNA allows efficient separation of large and small subunit precursors. Furthermore, loss of Nol12 leads to apoptosis.
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
Inquiry