Recombinant Protein of Mouse NOL12, aa 1-217(Cat#: RIJL-1124-JL150)
This product is a recombinant mouse NOL12 protein with specific tag. It is availible for positive control, immunogen and SDS-PAGE.
Summary
Related Products & Services
Description
|
This product is a recombinant mouse NOL12 protein with specific tag. It is availible for positive control, immunogen and SDS-PAGE. |
Product Property
Species Reactivity |
Mouse |
Purity |
>85% determined by SDS-PAGE |
Endotoxin |
Low endotoxin |
Expression Host |
Yeast; E.coli; Baculovirus; Mammalian Cell |
Formulation |
PBS with 6% trehalose |
Residues |
1-217aa |
Sequence |
MGRNKKKKKRDGDDRRPRLVLNFDEEKRREYLTGFHKRKVERKKAAIEEIKQRLKQEQKKLREERHQEYLKMLAEREEALEEADELERLVTAKTESVQYDHPNHTVTVTTISDLDLSGARLLGLPLPEQGDQDGSQEEEMSSLEKPTKALPRKSKDPLLSQRISSLTATLHAHSRKKVKRKHPRRAQDSTKKPPSATRTSKTQRRRRMTGKARHNGE |
Product Form |
Lyophilized powder |
Tags |
Tag type will be determined during the manufacturing process. |
Type |
Recombinant Protein |
Applications |
Positive Control; Immunogen; SDS-PAGE |
Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
Alternative Names |
Nol12; Nop25; Nucleolar protein 12; Nucleolar protein of 25 kDa |
Gene ID |
97961 |
UniProt ID |
Q8BG17 |
Location |
Nucleus; Nucleolus |
Introduction |
NOL12 is present in different subcellular compartments, including the nucleolus and nucleoplasm. Binding of NOL12 to ribosomal RNA allows efficient separation of large and small subunit precursors. Furthermore, loss of Nol12 leads to apoptosis. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.