Recombinant Protein of Rat NOL12, aa 1-216(Cat#: RIJL-1124-JL151)
This product is a recombinant rat NOL12 protein with specific tag. It is availible for positive control, immunogen and SDS-PAGE.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant rat NOL12 protein with specific tag. It is availible for positive control, immunogen and SDS-PAGE. |
Product Property
| Species Reactivity | Rat |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | Low endotoxin |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | PBS with 6% trehalose |
| Residues | 1-216aa |
| Sequence | MGRNKKKKRDGDDRRPRLILNFDEEKRREYLTGFHKRKVERKKAAIEEIKQRLKQEQKKLREERHQEYLKMLAEREEALEEADELERLVTAKTESVQYDHPNHTVTVTTVSDLDLSGARLLGLPLPEQGDQDGSQEEEVSSMEKPTKALPKKSKDPLLSQRISSLTATLHAHSRKKVKRKHPRRAQDSTKKPPSATRTSKTQRRRRMTGKARHNGE |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | Positive Control; Immunogen; SDS-PAGE |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Nol12; Nop25; Nucleolar protein 12; Nucleolar protein of 25 kDa |
| Gene ID | 362955 |
| UniProt ID | Q5D1Z3 |
| Location | Nucleus; Nucleolus |
| Introduction | NOL12 is present in different subcellular compartments, including the nucleolus and nucleoplasm. Binding of NOL12 to ribosomal RNA allows efficient separation of large and small subunit precursors. Furthermore, loss of Nol12 leads to apoptosis. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
