Recombinant Protein of Mouse MRPS2, aa 1-291(Cat#: RIJL-0225-JL466)
This product is a recombinant mouse MRPS2 protein with specific tag. It is availible for ELISA, immunogen, SDS-PAGE, WB and bioactivity testing.
Summary
Related Products & Services
Description
|
This product is a recombinant mouse MRPS2 protein with specific tag. It is availible for ELISA, immunogen, SDS-PAGE, WB and bioactivity testing. |
Product Property
Species Reactivity |
Mouse |
Molecule Mass |
32.3 kDa |
Purity |
>85% determined by SDS-PAGE |
Endotoxin |
<1.0EU per 1µg (determined by the LAL method) |
Expression Host |
Yeast; E.coli; Baculovirus; Mammalian Cell |
Formulation |
Tris/PBS-based buffer, 6% Trehalose |
Residues |
1-291aa |
Sequence |
MAPAPAVLTRLLCAGVRRWPGFLQKAIPGPAEQNGRKVTGAPVPAVSEPQDGDDFQSRILDTPLQHSDFFNVKELFSVKSLFEARVHLGHKAGCRHRFMEPYIFGNRLGQDIIDLDQTALNLQLALNFTAHVAYRKGIILFVSRNRQFSHLIETTAQACGEYAHTRYFKGGLLTNAQLLFGPSVRLPDLIIFLHTLNNVFEPHVAVRDAAKMNIPTVGIVDTNCNPCLITYPIPGNDDSPQAIQLFCKLFRTTINRAKEKRRQMEALHRLQSPKGSEGSGTSPVPDKSHSP |
Product Form |
Lyophilized powder |
Tags |
Tag type will be determined during the manufacturing process. |
Type |
Recombinant Protein |
Applications |
ELISA; Immunogen; SDS-PAGE; WB; Bioactivity Testing |
Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
Alternative Names |
Mitochondrial Ribosomal Protein S2; Mitochondrial Small Ribosomal Subunit Protein US2m; Small Ribosomal Subunit Protein US2m; MRP-S2 |
Gene ID |
118451 |
UniProt ID |
Q924T2 |
Location |
Mitochondrion |
Introduction |
MRPS2 is a fundamental protein within the small ribosomal subunit of mitochondria. It is ubiquitously distributed across various tissues and organs, underscoring its broad importance in cellular function. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.