Recombinant Protein of Mouse MRPS2, aa 1-291(Cat#: RIJL-0225-JL466)
This product is a recombinant mouse MRPS2 protein with specific tag. It is availible for ELISA, immunogen, SDS-PAGE, WB and bioactivity testing.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant mouse MRPS2 protein with specific tag. It is availible for ELISA, immunogen, SDS-PAGE, WB and bioactivity testing. |
Product Property
| Species Reactivity | Mouse |
| Molecule Mass | 32.3 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 1-291aa |
| Sequence | MAPAPAVLTRLLCAGVRRWPGFLQKAIPGPAEQNGRKVTGAPVPAVSEPQDGDDFQSRILDTPLQHSDFFNVKELFSVKSLFEARVHLGHKAGCRHRFMEPYIFGNRLGQDIIDLDQTALNLQLALNFTAHVAYRKGIILFVSRNRQFSHLIETTAQACGEYAHTRYFKGGLLTNAQLLFGPSVRLPDLIIFLHTLNNVFEPHVAVRDAAKMNIPTVGIVDTNCNPCLITYPIPGNDDSPQAIQLFCKLFRTTINRAKEKRRQMEALHRLQSPKGSEGSGTSPVPDKSHSP |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | ELISA; Immunogen; SDS-PAGE; WB; Bioactivity Testing |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Mitochondrial Ribosomal Protein S2; Mitochondrial Small Ribosomal Subunit Protein US2m; Small Ribosomal Subunit Protein US2m; MRP-S2 |
| Gene ID | 118451 |
| UniProt ID | Q924T2 |
| Location | Mitochondrion |
| Introduction | MRPS2 is a fundamental protein within the small ribosomal subunit of mitochondria. It is ubiquitously distributed across various tissues and organs, underscoring its broad importance in cellular function. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
