Loading...
Book a Meeting

Recombinant Protein of Mouse MRPL12, aa 47-201(Cat#: RIJL-0225-JL398)

This product is a recombinant mouse MRPL12 protein with specific tag. It is availible for ELISA and WB.

Certificate of Analysis (COA)

To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].

Lot Number
Summary Related Products & Services

Description

This product is a recombinant mouse MRPL12 protein with specific tag. It is availible for ELISA and WB.

Product Property

Species Reactivity Mouse
Molecule Mass 21.7 kDa
Purity >90% determined by SDS-PAGE
Endotoxin <1.0EU per 1µg (determined by the LAL method)
Expression Host Yeast; E.coli; Baculovirus; Mammalian Cell
Formulation Tris/PBS-based buffer, 6% Trehalose
Residues 47-201aa
Sequence EALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLMPMGGMVPGPVSAAAPASEAAEEEDVPKQKERTHFTVRLTEAKPVDKVKLIKEIKNYVQGINLVQAKKLVESLPQEIKANVAKAEAEKIKAALEAVGGTVVLE
Product Form Lyophilized powder
Tags Tag type will be determined during the manufacturing process.
Type Recombinant Protein
Applications ELISA; Western Blot
Storage Store at -20°C/-80°C. Avoid freeze-thaw cycles.

Target

Alternative Names Large Ribosomal Subunit Protein BL12m; Mitochondrial Large Ribosomal Subunit Protein BL12m; Mitochondrial Ribosomal Protein L12
Gene ID 6182
UniProt ID P52815
Location Mitochondrion
Introduction MRPL12, or Mitochondrial Ribosomal Protein L12, is a critical component of the large ribosomal subunit within the mitochondrial ribosome of eukaryotic cells. It serves as a structural scaffold that is essential for the stability and functional integrity of the mitochondrial ribosome.
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
Inquiry