Recombinant Protein of Mouse MRPL12, aa 47-201(Cat#: RIJL-0225-JL398)
This product is a recombinant mouse MRPL12 protein with specific tag. It is availible for ELISA and WB.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant mouse MRPL12 protein with specific tag. It is availible for ELISA and WB. |
Product Property
| Species Reactivity | Mouse |
| Molecule Mass | 21.7 kDa |
| Purity | >90% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 47-201aa |
| Sequence | EALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLMPMGGMVPGPVSAAAPASEAAEEEDVPKQKERTHFTVRLTEAKPVDKVKLIKEIKNYVQGINLVQAKKLVESLPQEIKANVAKAEAEKIKAALEAVGGTVVLE |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | ELISA; Western Blot |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Large Ribosomal Subunit Protein BL12m; Mitochondrial Large Ribosomal Subunit Protein BL12m; Mitochondrial Ribosomal Protein L12 |
| Gene ID | 6182 |
| UniProt ID | P52815 |
| Location | Mitochondrion |
| Introduction | MRPL12, or Mitochondrial Ribosomal Protein L12, is a critical component of the large ribosomal subunit within the mitochondrial ribosome of eukaryotic cells. It serves as a structural scaffold that is essential for the stability and functional integrity of the mitochondrial ribosome. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
