Recombinant Protein of Mouse DAP3, aa 1-238(Cat#: RIJL-1124-JL221)
This product is a recombinant mouse DAP3 protein with N-terminal His tag. It is availible for immunogen, SDS-PAGE and WB.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant mouse DAP3 protein with N-terminal His tag. It is availible for immunogen, SDS-PAGE and WB. |
Product Property
| Species Reactivity | Mouse |
| Molecule Mass | 31kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | PBS, pH 7.4, containing 0.01% SKL and 5% trehalose |
| Residues | 1-238aa |
| Sequence | MLTGITRLFSRVQKLDPRCFLHMSVQATQNSQVPAERPRTVSRTSDSDPAKHGEQHEGQHYSIPLQDLKTVFPHGLPPRYMMQVKTFGEACLMVRKPALELLGYLKNTNFAHPAVRYLLYGEKGTGKTLSLCHAVHFCARHDWLILHIPDAHLWVKNCRELLQSTHNKQRFDQPLEASTWLKNFKTTNERFLSQIKVQEKYVWNKRESTEKGSPLGEVVEQGLTRVRNATDAVGVVLK |
| Product Form | Lyophilized powder |
| Tags | N-terminal His Tag |
| Type | Recombinant Protein |
| Applications | Immunogen; SDS-PAGE; WB |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | MRP-S29; MRPS29; bMRP-10; 28S Ribosomal Protein S29,Mitochondrial; Ionizing radiation resistance conferring protein |
| Gene ID | 65111 |
| UniProt ID | Q9DCV6 |
| Location | Mitochondrion |
| Introduction | The DAP3 gene encodes the 28S subunit protein of mitochondrial ribosomes and plays an indispensable role in cellular respiration, translation and apoptosis. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
