Recombinant Protein of Maize RPL17, aa 1-171(Cat#: RIJL-0225-JL262)
This product is a recombinant maize RPL17 protein with N-terminal His Tag. It is availible for ELISA.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant maize RPL17 protein with N-terminal His Tag. It is availible for ELISA. |
Product Property
| Species Reactivity | Maize |
| Molecule Mass | 19.5 kDa |
| Purity | >90% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast |
| Formulation | Tris-based buffer, 50 % glycerol |
| Residues | 1-171aa |
| Sequence | MVKYSQEPGNPTKSAKAMGRDLRVHFKNTRETAFALRKLPLTKAKRYLEDVIAHKQAIPFRRYCGGVGRTAQAKSRHSNGQGRWPVKSARFILDLLKNAESNADVKGLDVDNLYVSHIQVNQAQKQRRRTYRAHGRINPYMSSPCHIELILSEKEEPVKKEADNIVAARKQ |
| Product Form | Lyophilized powder |
| Tags | N-terminal His Tag |
| Type | Recombinant Protein |
| Applications | ELISA |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Ribosomal Protein L17; Large Ribosomal Subunit Protein UL22; 60S Ribosomal Protein L17; 60S Ribosomal Protein L23 |
| Gene ID | 541667 |
| UniProt ID | O48557 |
| Location | Cytoplasm |
| Introduction | RPL17 protein is an essential component of the 60S subunit. This protein is found in the cytoplasm. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
