Recombinant Protein of Human RPS27L, aa 2-84(Cat#: RIJL-0225-JL382)
This product is a recombinant human RPS27L protein with specific tag. It is availible for WB and ELISA.
Summary
Related Products & Services
Description
|
This product is a recombinant human RPS27L protein with specific tag. It is availible for WB and ELISA. |
Product Property
| Species Reactivity |
Human |
| Molecule Mass |
9.5 kDa |
| Purity |
>90% determined by SDS-PAGE |
| Endotoxin |
<1.0EU per 1µg (determined by the LAL method) |
| Expression Host |
E.coli |
| Formulation |
10 mM Hepes, 150 mM NaCl with 5% trehalose, pH 7.4 |
| Residues |
2-84aa |
| Sequence |
PLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH |
| Product Form |
Lyophilized powder |
| Tags |
Tag type will be determined during the manufacturing process. |
| Type |
Recombinant Protein |
| Applications |
Western Blot; ELISA |
| Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names |
Ribosomal Protein S27 Like; 40S Ribosomal Protein S27-Like; Ribosomal Protein S27-Like |
| Gene ID |
51065 |
| UniProt ID |
Q71UM5 |
| Location |
Nucleus; Cytoplasm; Nucleolus |
| Introduction |
RPS27L, or Ribosomal Protein S27-Like, is a unique protein that exhibits structural similarity to ribosomal proteins despite not being a direct component of the ribosomal complex. It is involved in various cellular processes, including protein synthesis regulation and cell cycle progression. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.