Recombinant Protein of Human RPS27L, aa 2-84(Cat#: RIJL-0225-JL382)
This product is a recombinant human RPS27L protein with specific tag. It is availible for WB and ELISA.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human RPS27L protein with specific tag. It is availible for WB and ELISA. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 9.5 kDa |
| Purity | >90% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | 10 mM Hepes, 150 mM NaCl with 5% trehalose, pH 7.4 |
| Residues | 2-84aa |
| Sequence | PLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | Western Blot; ELISA |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Ribosomal Protein S27 Like; 40S Ribosomal Protein S27-Like; Ribosomal Protein S27-Like |
| Gene ID | 51065 |
| UniProt ID | Q71UM5 |
| Location | Nucleus; Cytoplasm; Nucleolus |
| Introduction | RPS27L, or Ribosomal Protein S27-Like, is a unique protein that exhibits structural similarity to ribosomal proteins despite not being a direct component of the ribosomal complex. It is involved in various cellular processes, including protein synthesis regulation and cell cycle progression. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
