Recombinant Protein of Human RPL10A, aa 4-215(Cat#: RIJL-0225-JL243)
This product is a recombinant human RPL10A protein with N-terminal GST-tag. It is availible for bioactivity testing, ELISA, immunogen, SDS-PAGE and WB.
Summary
Related Products & Services
Description
|
This product is a recombinant human RPL10A protein with N-terminal GST-tag. It is availible for bioactivity testing, ELISA, immunogen, SDS-PAGE and WB. |
Product Property
| Species Reactivity |
Human |
| Molecule Mass |
51.2 kDa |
| Purity |
>85% determined by SDS-PAGE |
| Endotoxin |
<1.0EU per 1µg (determined by the LAL method) |
| Expression Host |
E.coli |
| Formulation |
10 mM Hepes, 150 mM NaCl with 5% trehalose, pH 7.4 |
| Residues |
4-215aa |
| Sequence |
KVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFSGTVRLKSTPRPKFSVCVLGDQQHCDEAKAVDIPHMDIEALKKLNKNKKLVKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTDDELVYNIHLAVNFLVSLLKKNWQNVRALYIKSTMGKPQR |
| Product Form |
Lyophilized powder |
| Tags |
N-terminal GST-tag |
| Type |
Recombinant Protein |
| Applications |
Bioactivity Testing; ELISA; Immunogen; SDS-PAGE; WB |
| Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names |
Ribosomal Protein L10a; NEDD6; Neural Precursor Cell Expressed Developmentally Down-Regulated Protein 6; 60S Ribosomal Protein L10a; CSA-19 |
| Gene ID |
4736 |
| UniProt ID |
P62906 |
| Location |
Cytoplasm |
| Introduction |
The RPL10A gene encodes a ribosomal protein that constitutes a part of the 60S subunit, belonging to the L1P family of ribosomal proteins. This protein resides within the cytoplasm. Notably, the expression of the RPL10A gene is suppressed in the thymus when an immunosuppressive drug is administered. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.