Recombinant Protein of Human MRPS7, aa 1-242(Cat#: RIJL-0225-JL473)
This product is a recombinant human MRPS7 protein with GST Tag. It is availible for ELISA, affinity purification (AP), antibody array (AA) and WB.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human MRPS7 protein with GST Tag. It is availible for ELISA, affinity purification (AP), antibody array (AA) and WB. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 54.6 kDa |
| Purity | >90% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Wheat Germ |
| Formulation | 50 mM Tris HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
| Residues | 1-242aa |
| Sequence | MVAPAVKVARGWSGLALGVRRAVLQLPGLTQVRWSRYSPEFKDPLIDKEYYRKPVEELTEEEKYVRELKKTQLIKAAPAGKTSSVFEDPVISKFTNMMMIGGNKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERNPYTIFHQALKNCEPMIGLVPILKGGRFYQVPVPLPDRRRRFLAMKWMITECRDKKHQRTLMPEKLSHKLLEAFHNQGPVIKRKHDLHKMAEANRALAHYRWW |
| Product Form | Lyophilized powder |
| Tags | GST Tag |
| Type | Recombinant Protein |
| Applications | ELISA; Affinity Purification (AP); Antibody Array (AA); WB |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | MRP-S; MRP-S7; Ribosomal protein S7; RPMS7; S7mt; RP-S7; MRPS7; BMRP-27a; BMRP27a |
| Gene ID | 51081 |
| UniProt ID | Q9Y2R9 |
| Location | Mitochondrion |
| Introduction | MRPS7 serves as a pivotal protein constituent within the mitochondrial small ribosomal subunit. Alterations or mutations in this protein have been linked to a diverse array of conditions, encompassing mitochondrial encephalomyopathies and various other metabolic disturbances. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
