Recombinant Protein of Human MRPS30, aa 1-439(Cat#: RIJL-0225-JL525)
This product is a recombinant human MRPS30 protein with N-terminal Flag Tag. It is availible for immunogen, SDS-PAGE and WB.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human MRPS30 protein with N-terminal Flag Tag. It is availible for immunogen, SDS-PAGE and WB. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 74.0 kDa |
| Purity | >90% determined by SDS-PAGE |
| Endotoxin | Low endotoxin |
| Expression Host | Wheat Germ |
| Formulation | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
| Residues | 1-439aa |
| Sequence | MAAARCWRPLLRGPRLSLHTAANAAATATETTCQDVAATPVARYPPIVASMTADSKAARLRRIERWQATVHAAESVDEKLRILTKMQFMKYMVYPQTFALNADRWYQYFTKTVFLSGLPPPPAEPEPEPEPEPEPALDLAALRAVACDCLLQEHFYLRRRRRVHRYEESEVISLPFLDQLVSTLVGLLSPHNPALAAAALDYRCPVHFYWVRGEEIIPRGHRRGRIDDLRYQIDDKPNNQIRISKQLAEFVPLDYSVPIEIPTIKCKPDKLPLFKRQYENHIFVGSKTADPCCYGHTQFHLLPDKLRRERLLRQNCADQIEVVFRANAIASLFAWTGAQAMYQGFWSEADVTRPFVSQAVITDGKYFSFFCYQLNTLALTTQADQNNPRKNICWGTQSKPLYETIEDNDVKGFNDDVLLQIVHFLLNRPKEEKSQLLEN |
| Product Form | Lyophilized powder |
| Tags | N-terminal Flag Tag |
| Type | Recombinant Protein |
| Applications | Immunogen; SDS-PAGE; WB |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Mitochondrial Ribosomal Protein S30; PDCD9; Large Ribosomal Subunit Protein MS30; MRP-S30; Mitochondrial Large Ribosomal Subunit Protein MS30 |
| Gene ID | 10884 |
| UniProt ID | Q9NP92 |
| Location | Mitochondrion |
| Introduction | MRPS30 protein is integral to the efficient translation of mitochondrial genes, which is vital for the generation of ATP and other essential metabolic processes. Localized specifically within the mitochondria, MRPS30 ensures the fidelity of mitochondrial protein production. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
