Recombinant Protein of Human MRPS25, aa 1-173(Cat#: RIJL-0225-JL513)
This product is a recombinant human MRPS25 protein with N-terminal His Tag. It is availible for WB and ELISA.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human MRPS25 protein with N-terminal His Tag. It is availible for WB and ELISA. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 22.0 kDa |
| Purity | >90% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | 10 mM Hepes, 150 mM NaCl with 5% trehalose, pH 7.4 |
| Residues | 1-173aa |
| Sequence | MPMKGRFPIRRTLQYLSQGNVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILGKNEETLREEEEEKKQLSHPANFGPRKYCLRECICEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD |
| Product Form | Lyophilized powder |
| Tags | N-terminal His Tag |
| Type | Recombinant Protein |
| Applications | Western Blot; ELISA |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | MRPS25; RPMS25; MRP-S25; S25mt |
| Gene ID | 64432 |
| UniProt ID | P82663 |
| Location | Mitochondrion |
| Introduction | MRPS25 protein serves as a crucial element within the small subunit of the mitochondrial ribosome. Genetic mutations or alterations in the MRPS25 gene have been associated with a broad array of mitochondrial disorders, encompassing conditions like lactic acidosis and stroke-like episodes known as MELAS, alongside other syndromes marked by impaired mitochondrial function and disrupted energy metabolism. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
