Recombinant Protein of Human MRPS17, aa 1-130(Cat#: RIJL-0225-JL494)
This product is a recombinant human MRPS17 protein with N-terminal His Tag. It is availible for ELISA, immunogen, SDS-PAGE, WB and bioactivity testing.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human MRPS17 protein with N-terminal His Tag. It is availible for ELISA, immunogen, SDS-PAGE, WB and bioactivity testing. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 16.7 kDa |
| Purity | >90% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol |
| Residues | 1-130aa |
| Sequence | MSVVRSSVHARWIVGKVIGTKMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTVGDIVLLRALPVPRAKHVKHELAEIVFKVGKVIDPVTGKPCAGTTYLESPLSSETTQLSKNLEELNISSAQ |
| Product Form | Lyophilized powder |
| Tags | N-terminal His Tag |
| Type | Recombinant Protein |
| Applications | ELISA; Immunogen; SDS-PAGE; WB; Bioactivity Testing |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | 28S ribosomal protein S17; 28S ribosomal protein S17 mitochondrial; HSPC011; Mitochondrial ribosomal protein S17; MRP S17; MRP-S17 |
| Gene ID | 51373 |
| UniProt ID | Q9Y2R5 |
| Location | Mitochondrion |
| Introduction | MRPS17 protein plays a fundamental role in the synthesis of proteins within mitochondria. Distributed throughout the mitochondrial matrix, MRPS17 is indispensable for the accurate translation of mitochondrial mRNAs into functional proteins. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
