Recombinant Protein of Bovine MRPS17, aa 1-130(Cat#: RIJL-0225-JL495)
This product is a recombinant bovine MRPS17 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB.
Summary
Related Products & Services
Description
|
This product is a recombinant bovine MRPS17 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB. |
Product Property
Species Reactivity |
Bovine |
Molecule Mass |
14.5 kDa |
Purity |
>85% determined by SDS-PAGE |
Endotoxin |
<1.0EU per 1µg (determined by the LAL method) |
Expression Host |
E.coli |
Formulation |
Tris/PBS-based buffer, 6% Trehalose |
Residues |
1-130aa |
Sequence |
MSVVRSSVHAKWIVGKVIGTAMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTVGDIVLLKALPVPRTKHVKHELAEIVFKVGQVVDPVTGKRCAGTTYLESPVDLETTPLAKNLEELSLSTTQ |
Product Form |
Lyophilized powder |
Tags |
Tag type will be determined during the manufacturing process. |
Type |
Recombinant Protein |
Applications |
Immunogen; SDS-PAGE; WB |
Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
Alternative Names |
Mitochondrial ribosomal protein S17; MRP S17; MRP-S17; 28S ribosomal protein S17; 28S ribosomal protein S17 mitochondrial; HSPC011 |
Gene ID |
508143 |
UniProt ID |
P82916 |
Location |
Mitochondrion |
Introduction |
MRPS17 protein plays a fundamental role in the synthesis of proteins within mitochondria. Distributed throughout the mitochondrial matrix, MRPS17 is indispensable for the accurate translation of mitochondrial mRNAs into functional proteins. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.