Loading...
Book a Meeting

Recombinant Protein of Bovine MRPS17, aa 1-130(Cat#: RIJL-0225-JL495)

This product is a recombinant bovine MRPS17 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB.

Certificate of Analysis (COA)

To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].

Lot Number
Summary Related Products & Services

Description

This product is a recombinant bovine MRPS17 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB.

Product Property

Species Reactivity Bovine
Molecule Mass 14.5 kDa
Purity >85% determined by SDS-PAGE
Endotoxin <1.0EU per 1µg (determined by the LAL method)
Expression Host E.coli
Formulation Tris/PBS-based buffer, 6% Trehalose
Residues 1-130aa
Sequence MSVVRSSVHAKWIVGKVIGTAMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTVGDIVLLKALPVPRTKHVKHELAEIVFKVGQVVDPVTGKRCAGTTYLESPVDLETTPLAKNLEELSLSTTQ
Product Form Lyophilized powder
Tags Tag type will be determined during the manufacturing process.
Type Recombinant Protein
Applications Immunogen; SDS-PAGE; WB
Storage Store at -20°C/-80°C. Avoid freeze-thaw cycles.

Target

Alternative Names Mitochondrial ribosomal protein S17; MRP S17; MRP-S17; 28S ribosomal protein S17; 28S ribosomal protein S17 mitochondrial; HSPC011
Gene ID 508143
UniProt ID P82916
Location Mitochondrion
Introduction MRPS17 protein plays a fundamental role in the synthesis of proteins within mitochondria. Distributed throughout the mitochondrial matrix, MRPS17 is indispensable for the accurate translation of mitochondrial mRNAs into functional proteins.
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
Inquiry