Recombinant Protein of Human MRPS14, aa 1-128(Cat#: RIJL-0225-JL485)
This product is a recombinant human MRPS14 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human MRPS14 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 15.1 kDa |
| Purity | >90% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 1-128aa |
| Sequence | MAAFMLGSLLRTFKQMVPSSASGQVRSHYVDWRMWRDVKRRKMAYEYADERLRINSLRKNTILPKILQDVADEEIAALPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQLSGIQRATW |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | Immunogen; SDS-PAGE; WB |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | MRPS14; 28S ribosomal protein S14; MRP-S14; S14mt; Mitochondrial small ribosomal subunit protein uS14m |
| Gene ID | 63931 |
| UniProt ID | O60783 |
| Location | Mitochondrion |
| Introduction | The MRPS14 protein is ubiquitously expressed in a wide range of tissues and cells, where it facilitates the accurate translation of mitochondrial mRNAs into functional proteins. Mutations or deletions in the MRPS14 gene have been linked to several genetic disorders, including mitochondrial encephalomyopathy, lactic acidosis, and stroke-like episodes (MELAS). |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
