Recombinant Protein of Mouse MRPS14, aa 1-128(Cat#: RIJL-0225-JL487)
This product is a recombinant mouse MRPS14 protein with specific tag. It is availible for WB, bioactivity testing, immunogen, ELISA and SDS-PAGE.
Summary
Related Products & Services
Description
|
This product is a recombinant mouse MRPS14 protein with specific tag. It is availible for WB, bioactivity testing, immunogen, ELISA and SDS-PAGE. |
Product Property
| Species Reactivity |
Mouse |
| Molecule Mass |
14.9 kDa |
| Purity |
>85% determined by SDS-PAGE |
| Endotoxin |
<1.0EU per 1µg (determined by the LAL method) |
| Expression Host |
Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation |
Tris/PBS-based buffer, 6% Trehalose |
| Residues |
1-128aa |
| Sequence |
MAASVLGSLLRTFRQAVPPSASGQVRGYYVDWRMLRDLKRRKMAYEYADERLRINSLRKNTILPKDLQEMAGDEIAALPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGLLSGVQRAIW |
| Product Form |
Lyophilized powder |
| Tags |
Tag type will be determined during the manufacturing process. |
| Type |
Recombinant Protein |
| Applications |
WB; Bioactivity Testing; Immunogen; ELISA; SDS-PAGE |
| Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names |
Mitochondrial small ribosomal subunit protein uS14m; MRPS14; 28S ribosomal protein S14; MRP-S14; S14mt |
| Gene ID |
64659 |
| UniProt ID |
Q9CR88 |
| Location |
Mitochondrion |
| Introduction |
The MRPS14 protein is ubiquitously expressed in a wide range of tissues and cells, where it facilitates the accurate translation of mitochondrial mRNAs into functional proteins. Mutations or deletions in the MRPS14 gene have been linked to several genetic disorders, including mitochondrial encephalomyopathy, lactic acidosis, and stroke-like episodes (MELAS). |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.