Recombinant Protein of Human MRPS11, aa 1-194(Cat#: RIJL-0225-JL481)
This product is a recombinant human MRPS11 protein with N-terminal GST Tag. It is availible for affinity purification (AP), antibody array (AA), ELISA and WB.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human MRPS11 protein with N-terminal GST Tag. It is availible for affinity purification (AP), antibody array (AA), ELISA and WB. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 47.0 kDa |
| Purity | >90% determined by SDS-PAGE |
| Endotoxin | Low endotoxin |
| Expression Host | Wheat Germ |
| Formulation | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
| Residues | 1-194aa |
| Sequence | MQAVRNAGSRFLRSWTWPQTAGRVVARTPAGTICTGARQLQDAAAKQKVEQNAAPSHTKFSIYPPIPGEESSLRWAGKKFEEIPIAHIKASHNNTQIQVVSASNEPLAFASCGTEGFRNAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGPGRLSAMHGLIMGGLEVISITDNTPIPHNGCRPRKARKL |
| Product Form | Lyophilized powder |
| Tags | N-terminal GST Tag |
| Type | Recombinant Protein |
| Applications | Affinity Purification (AP); Antibody Array (AA); ELISA; WB |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | RPMS11; S11mt; HCC-2; MRPS11; MRP-S11 |
| Gene ID | 64963 |
| UniProt ID | P82912 |
| Location | Mitochondrion |
| Introduction | MRPS11 is essential for the proper functioning of the mitochondrial ribosome, which in turn is vital for energy production within cells through oxidative phosphorylation. Mutations or alterations in the MRPS11 gene can lead to disruptions in mitochondrial protein synthesis and energy metabolism, potentially causing a range of genetic disorders that affect cellular energy levels and overall health. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
