Recombinant Protein of Human MRPL9, aa 60-267(Cat#: RIJL-0225-JL391)
This product is a recombinant human MRPL9 protein with N-terminal GST Tag. It is availible for SDS-PAGE, ELISA, immunogen, bioactivity testing and WB.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human MRPL9 protein with N-terminal GST Tag. It is availible for SDS-PAGE, ELISA, immunogen, bioactivity testing and WB. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 50.9 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 60-267aa |
| Sequence | WKVPLAGEGRKPRLHRRHRVYKLVEDTKHRPKENLELILTQSVENVGVRGDLVSVKKSLGRNRLLPQGLAVYASPENKKLFEEEKLLRQEGKLEKIQTKAGEATVKFLKSCRLEVGMKNNVKWELNPEIVARHFFKNLGVVVAPHTLKLPEEPITRWGEYWCEVTVNGLDTVRVPMSVVNFEKPKTKRYKYWLAQQAAKAMAPTSPQI |
| Product Form | Lyophilized powder |
| Tags | N-terminal GST Tag |
| Type | Recombinant Protein |
| Applications | SDS-PAGE; ELISA; Immunogen; Bioactivity Testing; WB |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Mitochondrial Ribosomal Protein L9; Large Ribosomal Subunit Protein BL9m; Mitochondrial Large Ribosomal Subunit Protein BL9m |
| Gene ID | 65005 |
| UniProt ID | Q9BYD2 |
| Location | Mitochondrion |
| Introduction | MRPL9, or Mitochondrial Ribosomal Protein L9, is an integral part of the large ribosomal subunit in the mitochondrial ribosome of eukaryotic organisms. It plays a pivotal role in mitochondrial translation, facilitating the accurate synthesis of proteins that are crucial for oxidative phosphorylation and other essential mitochondrial functions. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
