Recombinant Protein of Human MRPL44, aa 1-332(Cat#: RIJL-0225-JL440)
This product is a recombinant human MRPL44 protein with C-terminal His Tag. It is availible for immunogen, SDS-PAGE, ELISA and standard.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human MRPL44 protein with C-terminal His Tag. It is availible for immunogen, SDS-PAGE, ELISA and standard. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 37.5 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Baculovirus-Insect Cells |
| Formulation | 20mM Tris, 500mM NaCl, pH 8.0 |
| Residues | 1-332aa |
| Sequence | MASGLVRLLQQGHRCLLAPVAPKLVPPVRGVKKGFRAAFRFQKELERQRLLRCPPPPVRRSEKPNWDYHAEIQAFGHRLQENFSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLKSNQELSEQGTSFSQTCLTQFLEDEYPDMPTEGIKNLVDFLTGEEVVCHVARNLAVEQLTLSEEFPVPPAVLQQTFFAVIGALLQSSGPERTALFIRDFLITQMTGKELFEMWKIINPMGLLVEELKKRNVSAPESRLTRQSGGTTALPLYFVGLYCDKKLIAEGPGETVLVAEEEAARVALRKLYGFTENRRPWNYSKPKETLRAEKSITAS |
| Product Form | Lyophilized powder |
| Tags | C-terminal His Tag |
| Type | Recombinant Protein |
| Applications | Immunogen; SDS-PAGE; ELISA; Standard |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Mitochondrial Ribosomal Protein L44; ML44; Large Ribosomal Subunit Protein ML44; MRP-L44; Mitochondrial Large Ribosomal Subunit Protein ML44 |
| Gene ID | 65080 |
| UniProt ID | Q9H9J2 |
| Location | Mitochondrion |
| Introduction | Serving as a constituent of the large ribosomal subunit, MRPL44 plays a pivotal role in ensuring the precise assembly and translation of mitochondrial mRNAs into fully functional proteins. Alterations or insufficiencies in the levels of this protein have been linked to a range of mitochondrial disorders. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
