Recombinant Protein of Bovine MRPL44, aa 31-332(Cat#: RIJL-0225-JL441)
This product is a recombinant bovine MRPL44 protein with specific tag. It is availible for SDS-PAGE, WB, bioactivity testing, ELISA and immunogen.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant bovine MRPL44 protein with specific tag. It is availible for SDS-PAGE, WB, bioactivity testing, ELISA and immunogen. |
Product Property
| Species Reactivity | Bovine |
| Molecule Mass | 37.4 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 31-332aa |
| Sequence | VKKGFRAAFRFQKELERWRLLRCPPPPVRRSEKPNWDYHAEIQAFGPRLQETFSLDLLKTAFVNSCYIKSEEAKRQKLGIEKEAVLLNLKDNQELSEQGTSFSQTCLTQFFEDAFPDLPTEGVKSLVDYLTGEEVVCHVARNLAVEQLTLSADFPVPPAVLRQTFFAVIGALLHSSGPERTSLFIRDFLITQMTGKELFEIWKIINPMGLLVQELKKRNISVPESRLTRQSGSTTALPVYFVGLYCDKKLIAEGPGETVLVAEEEAARVALRKLYGFTENRQPWDYSRPKEPVRAEKTIAAS |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | SDS-PAGE; WB; Bioactivity Testing; ELISA; Immunogen |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | MRP-L44; Mitochondrial Large Ribosomal Subunit Protein ML44; Mitochondrial Ribosomal Protein L44; ML44; Large Ribosomal Subunit Protein ML44 |
| Gene ID | 532389 |
| UniProt ID | Q2KIS2 |
| Location | Mitochondrion |
| Introduction | Serving as a constituent of the large ribosomal subunit, MRPL44 plays a pivotal role in ensuring the precise assembly and translation of mitochondrial mRNAs into fully functional proteins. Alterations or insufficiencies in the levels of this protein have been linked to a range of mitochondrial disorders. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
