Recombinant Protein of Human MRPL23, aa 1-153(Cat#: RIJL-0225-JL415)
This product is a recombinant human MRPL23 protein with specific tag. It is availible for ELISA, immunogen, SDS-PAGE, WB and bioactivity testing.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human MRPL23 protein with specific tag. It is availible for ELISA, immunogen, SDS-PAGE, WB and bioactivity testing. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 17.8 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 1-153aa |
| Sequence | MARNVVYPLYRLGGPQLRVFRTNFFIQLVRPGVAQPEDTVQFRIPMEMTRVDLRNYLEGIYNVPVAAVRTRVQHGSNKRRDHRNVRIKKPDYKVAYVQLAHGQTFTFPDLFPEKDESPEGSAADDLYSMLEEERQQRQSSDPRRGGVPSWFGL |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | ELISA; Immunogen; SDS-PAGE; WB; Bioactivity Testing |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Mitochondrial Ribosomal Protein L23; RPL23L; Large Ribosomal Subunit Protein UL23m; L23 Mitochondrial-Related Protein; Ribosomal Protein L23-Like |
| Gene ID | 6150 |
| UniProt ID | Q16540 |
| Location | Mitochondrion |
| Introduction | MRPL23, or Mitochondrial Ribosomal Protein L23, is a key component of the large ribosomal subunit in the mitochondrial ribosome of eukaryotic cells. It plays a vital role in the structural organization and functional activity of the mitochondrial translational apparatus, facilitating the synthesis of proteins essential for oxidative phosphorylation and other mitochondrial metabolic processes. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
