Recombinant Protein of Human MRPL21, aa 40-205(Cat#: RIJL-0225-JL411)
This product is a recombinant human MRPL21 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant human MRPL21 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB. |
Product Property
| Species Reactivity | Human |
| Molecule Mass | 13.7 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | E.coli |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 40-205aa |
| Sequence | NSQSTSYLPGYVPKTSLSSPPWPEVVLPDPVEETRHHAEVVKKVNEMIVTGQYGRLFAVVHFASRQWKVTSEDLILIGNELDLACGERIRLEKVLLVGADNFTLLGKPLLGKDLVRVEATVIEKTESWPRIIMRFRKRKNFKKKRIVTTPQTVLRINSIEIAPCLL |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | Immunogen; SDS-PAGE; WB |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Mitochondrial Ribosomal Protein L21; Large Ribosomal Subunit Protein BL21m; MRP-L21; Mitochondrial Large Ribosomal Subunit Protein BL21m |
| Gene ID | 219927 |
| UniProt ID | Q7Z2W9 |
| Location | Mitochondrion |
| Introduction | MRPL21, also known as Mitochondrial Ribosomal Protein L21, is a key structural component of the large ribosomal subunit within the mitochondrial ribosome of eukaryotic cells. It plays a vital role in facilitating the accurate translation of mitochondrial mRNAs into proteins, which are essential for energy production through oxidative phosphorylation. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
