Recombinant Protein of Bovine RPS24, aa 1-131(Cat#: RIJL-0225-JL372)
This product is a recombinant bovine RPS24 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB.
Summary
Related Products & Services
Description
|
This product is a recombinant bovine RPS24 protein with specific tag. It is availible for immunogen, SDS-PAGE and WB. |
Product Property
Species Reactivity |
Bovine |
Molecule Mass |
15.1 kDa |
Purity |
>85% determined by SDS-PAGE |
Endotoxin |
<1.0EU per 1µg (determined by the LAL method) |
Expression Host |
Yeast; E.coli; Baculovirus; Mammalian Cell |
Formulation |
Tris/PBS-based buffer, 6% Trehalose |
Residues |
1-131aa |
Sequence |
MNDTVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMKKVRGTAKANVGAGKKK |
Product Form |
Lyophilized powder |
Tags |
Tag type will be determined during the manufacturing process. |
Type |
Recombinant Protein |
Applications |
Immunogen; SDS-PAGE; WB |
Storage |
Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
Alternative Names |
Small Ribosomal Subunit Protein ES24; 40S Ribosomal Protein S24; Ribosomal Protein S24; DBA3 |
Gene ID |
530464 |
UniProt ID |
Q56JU9 |
Location |
Cytoplasm; Nucleolus; Nucleus |
Introduction |
In eukaryotic cells, RPS24 serves as an indispensable part of the small ribosomal subunit, playing a pivotal role in the translation process by enabling the assembly and facilitating the function of the ribosome-the molecular machinery tasked with synthesizing proteins. |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.