Recombinant Protein of Bovine MRPS22, aa 1-359(Cat#: RIJL-0225-JL506)
This product is a recombinant bovine MRPS22 protein with specific tag. It is availible for WB, bioactivity testing, immunogen, ELISA and SDS-PAGE.
Certificate of Analysis (COA)
To download the COA, please enter the product lot number in the following search box. For further assistance, you may also inquire via the following email address: [info@creative-biolabs.com].
Lot Number
Summary
Related Products & Services
Description
| This product is a recombinant bovine MRPS22 protein with specific tag. It is availible for WB, bioactivity testing, immunogen, ELISA and SDS-PAGE. |
Product Property
| Species Reactivity | Bovine |
| Molecule Mass | 40.7 kDa |
| Purity | >85% determined by SDS-PAGE |
| Endotoxin | <1.0EU per 1µg (determined by the LAL method) |
| Expression Host | Yeast; E.coli; Baculovirus; Mammalian Cell |
| Formulation | Tris/PBS-based buffer, 6% Trehalose |
| Residues | 1-359aa |
| Sequence | MATLRVSLSLWNLHAGSRGAGRVYFRARARPRPGDLFQPLPGVCGAGTPCRGLCSEAESGSPKIKKPTFMDEEVQSILIKMTGLDLLKIFKPAVQETKPPTYKLMTQAQLEEATRQAIEAAKVRLKMPPVLEERTPINDVLAEDKILEGTETGKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQIYFPKEGRRVLTPVIFREENLQTMYSQDRHVDVLNLCVAQFEPDSADYIKVHHQTYEDIDKYGKYDLLRSTRHFGGMAWYFVNKKKIDGLLIDQIQRDLVDDAASLVQLYHILHPDGQSAQEAKEQAAEGLQLIKVFAKTEAQKGAYIELTLQAYQEAFISSSAAS |
| Product Form | Lyophilized powder |
| Tags | Tag type will be determined during the manufacturing process. |
| Type | Recombinant Protein |
| Applications | WB; Bioactivity Testing; Immunogen; ELISA; SDS-PAGE |
| Storage | Store at -20°C/-80°C. Avoid freeze-thaw cycles. |
Target
| Alternative Names | Mitochondrial ribosomal protein S22; MRP-S22; MRPS22; RPM S22; RPMS22; 28S ribosomal protein S22 |
| Gene ID | 532044 |
| UniProt ID | P82649 |
| Location | Mitochondrion |
| Introduction | The MRPS22 protein plays a pivotal role in maintaining normal mitochondrial function and, consequently, energy production through oxidative phosphorylation. |
Related Products & Services
Related Services
Ribosome Separation & Extraction Service
Ribosome Analysis Services
Ribosomal Marker Antibody Development Service
Related Products
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry
